Codon reassignment is the biological process via which the way the genetic code of a cell is read is changed as a response to the environment. Typically codons, sets of three mRNA nucleotides, correspond to one specific amino acid.[1] Codon reassignment is the exception to this rule. When a codon is reassigned, it codes for a new amino acid.[2] This change in code can have immense consequences for the cell as protein structures are altered.

Mechanics of Codon Reassignment

edit

Normal Codon Behavior

edit
When read from the center out, this chart shows which amino acid a sequence of three nucleotides would normally code for. When codon reassignment occurs, the sequence of three nucleotides may code for a different amino acid.

Proteins are essential to life, performing many necessary cellular functions. Cells construct proteins with amino acids using DNA instructions. Typically, DNA is transcribed into messenger RNA (mRNA) and the mRNA is translated into a sequence of amino acids.[1] The complex that facilitates translation from mRNA to amino acid is called the ribosome.[1] Ribosomes hold and read mRNA in three nucleotide chunks called codons. Codons have a corresponding transport RNA (tRNA) that binds to the ribosome. tRNAs are responsible for bringing amino acids to the ribosome so they can be incorporated into the protein. Though each codon only codes for a single tRNA, a tRNA can represent multiple codons. This is because there are 64 possible codon combinations and 20 natural amino acids.[1] Each tRNA codes for a single amino acid. Each amino acid is added to the growing chain of amino acids that will form the final protein. The initial chain of amino acids, also called the primary structure of the protein, determines the final shape and functional capacity of the protein.[1]

Reassigned Codon Behavior

edit

When codon reassignment occurs, it is usually due to a change in tRNAs. A tRNA can be assigned to a new codon or the tRNA can be altered to pick up a different amino acid.[3] For the protein, this means either swapping one amino acid for another, or in the case of a stop codon, adding an amino acid where there was none before. Since the primary structure determines the functionality of a protein,[1] changing even one amino acid in this way can drastically impact what the final protein is able to do.

Examples of Codon Reassignment

edit

Amino acid deficiencies

edit

In bacteria and yeast, codon reassignment can be caused by a shortage of required amino acids.[3] Instead of halting protein production all together, tRNA molecules select another amino acid to add to the amino acid chain.[3] This amino acid may have similar properties to the intended amino acid, or it may not. This may cause deformities in the proteins, making them less efficient or even nonfunctional. A hypothesis as to why this phenomenon persists despite the loss of efficiency is that it is preferable for the organism to have a worse version of the protein than to have no protein at all.[3]

In some human cancer cells, such as melanoma cells, a similar tactic is used. As an immune response, to try and destroy the cancer, T cells release an enzyme that destroys the essential amino acid tryptophan within the cancer cells.[3] This typically deprives the cancer of many key proteins, killing the cancer cells. However, some cancer cells are able to use codon reassignment to replace the tryptophan with a similar amino acid called phenylalanine.[3] This amino acid replacement and resulting functional protein allows the cancer cell to survive and continue dividing.[citation needed]

Alteration of tRNAs

edit

In some bacteriophages, tRNAs have been assigned to stop codons TAG and TGA to code for amino acids glutamine and tryptophan respectively.[4] The reasons for this codon reassignment are still being studied, it may be related to the infection process.[4]

Exposure to outside environmental factors can alter tRNA molecules enough to result in codon reassignment. For example, after being infected with a certain virus, rat liver cells can replace the amino acid selenocysteine with cysteine, a structurally similar amino acid.[3]

Implications of Codon Reassignment

edit

Not-So Universal Genetic Code

edit

It has been well documented that there are variations in genetic code within between nucleic DNA, mitochondrial DNA and chloroplast DNA.[1][5] However, it was previously thought that the genetic code was consistent across species within the nucleus. The existence of codon reassignment challenges this idea.[5] The same codon may code for different amino acids in different species. Codon reassignment shows flexibility and adaptability within genetic code.[citation needed]

Potential Uses of Codon Reassignment

edit

Artificial, synthetic, unnatural, or non-proteinogenic amino acids are used in research to help understand the construction and functionality of proteins.[2] These artificial amino acids are also used in some medications.[6] Researchers normally use stop codons, which do not code for an amino acid, to insert these amino acids into proteins. Since there are only three stop codons, researchers were previously limited to using only one or two artificial amino acids.[2][6] There was also an option to use artificial tRNA molecules to insert artificial amino acids, but these artificial tRNA molecules are not as high quality as natural tRNA molecules, often making mistakes.[6] The ability to reassign natural tRNA to artificial amino acids through codon reassignment unlocks many possibilities for this research. Since there are 64 possible combinations and only about 20 natural amino acids,[1] this method would allow researchers to hypothetically insert 43 artificial amino acids into a protein, preserving one stop codon to complete the translation process properly. These advancements in genetic and protein manipulation may help scientists and doctors to deepen humanity's understanding of cellular functions and produce more effective and efficient medicines.[2][6]

See also

edit

References

edit
  1. ^ a b c d e f g h Alberts, Bruce; Johnson, Alexander; Lewis, Julian; Raff, Martin; Roberts, Keith; Walter, Peter (2002), "From RNA to Protein", Molecular Biology of the Cell. 4th edition, Garland Science, retrieved 2025-02-17
  2. ^ a b c d Dumas, Anaëlle; Lercher, Lukas; Spicer, Christopher D.; Davis, Benjamin G. (2014-12-01). "Designing logical codon reassignment – Expanding the chemistry in biology". Chemical Science. 6 (1): 50–69. doi:10.1039/C4SC01534G. ISSN 2041-6539. PMC 5424465. PMID 28553457.
  3. ^ a b c d e f g Pataskar, A.; Champagne, J.; Nagel, R.; Kenski, J.; Laos, M.; Michaux, J.; Pak, H. S.; Bleijerveld, O. B.; Mordente, K.; Navarro, J. M.; Blommaert, N.; Nielsen, M. M.; Lovecchio, D.; Stone, E.; Georgiou, G.; De Gooijer, M. C.; Van Tellingen, O.; Altelaar, M.; Joosten, R. P.; Perrakis, A.; Olweus, J.; Bassani-Sternberg, M.; Peeper, D. S.; Agami, R. (2025-02-13). "Tryptophan depletion results in tryptophan-to-phenylalanine substitutants - PMC". Nature. 603 (7902): 721–727. doi:10.1038/s41586-022-04499-2. PMC 8942854. PMID 35264796.
  4. ^ a b Cook, Ryan; Telatin, Andrea; Bouras, George; Camargo, Antonio Pedro; Larralde, Martin; Edwards, Robert A; Adriaenssens, Evelien M (2024-01-01). "Driving through stop signs: predicting stop codon reassignment improves functional annotation of bacteriophages". ISME Communications. 4 (1) ycae079. doi:10.1093/ismeco/ycae079. ISSN 2730-6151. PMC 11210395. PMID 38939532.
  5. ^ a b O'Sullivan, Justin M; Bernard Davenport, J; Tuite, Mick F (2001-01-01). "Codon reassignment and the evolving genetic code: problems and pitfalls in post-genome analysis". Trends in Genetics. 17 (1): 20–22. doi:10.1016/S0168-9525(00)02144-2. ISSN 0168-9525. PMID 11163917.
  6. ^ a b c d McFeely, Clinton A L; Dods, Kara K; Patel, Shivam S; Hartman, Matthew C T (2022-10-28). "Expansion of the genetic code through reassignment of redundant sense codons using fully modified tRNA". Nucleic Acids Research. 50 (19): 11374–11386. doi:10.1093/nar/gkac846. ISSN 0305-1048. PMC 9638912. PMID 36300637.


📚 Artikel Terkait di Wikipedia

Expanded genetic code

is an artificially modified genetic code in which one or more specific codons have been re-allocated to encode an amino acid that is not among the 22

Genetic code

"Novel Ciliate Genetic Code Variants Including the Reassignment of All Three Stop Codons to Sense Codons in Condylostoma magnum". Molecular Biology and Evolution

Auxotrophy

is not performed by codon manipulation at the DNA level (e.g. oligonucleotide-directed mutagenesis), but by codon reassignments at the level of protein

Aminoacyl tRNA synthetase

phenylalanine during tryptophan depletion, essentially inducing a W>F codon reassignment. Depletion of the other substrate of aminoacyl-tRNA synthetases, the

List of genetic codes

involve codon reassignments that are recapitulated in the DNA and RNA codon tables. Comparison of alternative translation tables for all codons (using

Invertebrate mitochondrial code

PMID 11027335. Sengupta S, Yang X, Higgs PG (June 2007). "The mechanisms of codon reassignments in mitochondrial genetic codes". Journal of Molecular Evolution.

Mold, protozoan, and coelenterate mitochondrial code and the mycoplasma/spiroplasma code

with slight variations, notably the use of UGA as a tryptophan codon rather than a stop codon.    AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG

Nediljko Budisa

non-canonical) amino acid analogs in proteins, preferably by sense codon reassignment. His methodology allows for fine chemical manipulations of a few amino